PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626235.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 277aa    MW: 32334.5 Da    PI: 7.1662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626235.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-172370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++++   G g+W++ a++ g++Rt+k+c++rw++yl
   XP_009626235.1 23 RGPWTLEEDNLLIHCISSNGEGRWNALAKCAGLKRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding52.89e-1776119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009626235.1  76 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.11870IPR017930Myb domain
SuperFamilySSF466891.6E-3020117IPR009057Homeodomain-like
SMARTSM007173.7E-152272IPR001005SANT/Myb domain
PfamPF002493.9E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-222477IPR009057Homeodomain-like
CDDcd001671.82E-102570No hitNo description
PROSITE profilePS5129425.75171125IPR017930Myb domain
SMARTSM007172.7E-1575123IPR001005SANT/Myb domain
PfamPF002499.0E-1676119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2378124IPR009057Homeodomain-like
CDDcd001671.02E-1080119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MSKGIVIMSN NSSNEDDQFE LRRGPWTLEE DNLLIHCISS NGEGRWNALA KCAGLKRTGK  60
SCRLRWLNYL KPDIKRGNLT PQEQLLILEL HSKWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKQARQLKV DSNSKKFVEA IKSLWMPRLL EKMEQSSSIE KHNPSLITPL INNQEPYDKA  180
KTSSFENSRI YSTDSMNMLK LQPNEMTQDF TIYNNSVQNE CYHVESLSQQ PHFSSQEMSI  240
SECEVAEAHW FSDEMAAASL WNMDEFWQFR KLGDIDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-25201251105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-252012524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626235.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE17e-68MY108_ARATH; Transcription factor MYB108
TrEMBLK4BX971e-130K4BX97_SOLLC; Uncharacterized protein
TrEMBLM1B5S11e-131M1B5S1_SOLTU; Uncharacterized protein
STRINGSolyc05g009230.1.11e-130(Solanum lycopersicum)
STRINGPGSC0003DMT4000377161e-130(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-93myb domain protein 62